PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g009440.2.1
Common NameLOC101253433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 239aa    MW: 26378.2 Da    PI: 4.8756
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g009440.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB152.76.8e-4859152295
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqdr++Pianv+r m+kvlP naki++++k ++qecvsefi+fvt+ea+d+c+ ekrkti+++dllw++ +lGf+dyvepl++yl++yre
  Solyc10g009440.2.1  59 REQDRLMPIANVVRNMRKVLPPNAKIADESKLVIQECVSEFIGFVTGEANDRCKLEKRKTITAEDLLWSMNSLGFDDYVEPLTLYLQRYRE 149
                         89***************************************************************************************** PP

               NF-YB  93 leg 95 
                         ++g
  Solyc10g009440.2.1 150 FDG 152
                         987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-4353156IPR009072Histone-fold
SuperFamilySSF471133.71E-3461158IPR009072Histone-fold
PfamPF008081.2E-1965128IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-1692110No hitNo description
PRINTSPR006151.2E-16111129No hitNo description
PRINTSPR006151.2E-16130148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MANNNNAGSG NGGFPSYRRS PQLTLARSPS SDMERSVELP SHLNQEIAAN EGDSECTIRE  60
QDRLMPIANV VRNMRKVLPP NAKIADESKL VIQECVSEFI GFVTGEANDR CKLEKRKTIT  120
AEDLLWSMNS LGFDDYVEPL TLYLQRYREF DGGDRGSLRG DPFPLKRPTV NPASGYSLIP  180
NHLPPNFPMA HHNGYYVYPP PVDNSYRQGD ASSGSTSHEF AVAAVDRDVE SPAEKSDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B3e-3658149192Transcription factor HapC (Eurofung)